PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10018693m
Common NameCARUB_v10018693mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 449aa    MW: 50665.4 Da    PI: 7.4812
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10018693mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.14.6e-19200246148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEd+llv++v+++G++ W+ Ia++++ gR +kqc++rw+++l
  Carubv10018693m 200 KGQWTSEEDKLLVKLVERHGTKKWSQIAKMLQ-GRVGKQCRERWHNHL 246
                      799*****************************.*************97 PP

2Myb_DNA-binding59.19.5e-19252294145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++WT+eEd++l++a+k+ G++ W+ Iar+++ gRt++ +k++w+
  Carubv10018693m 252 KDSWTEEEDQILIEAHKEIGNR-WAEIARKLP-GRTENTIKNHWN 294
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.702195250IPR017930Myb domain
SuperFamilySSF466891.58E-32197293IPR009057Homeodomain-like
SMARTSM007171.8E-16199248IPR001005SANT/Myb domain
PfamPF002493.7E-18200246IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.5E-29201254IPR009057Homeodomain-like
CDDcd001672.60E-15203246No hitNo description
PROSITE profilePS5129422.796251301IPR017930Myb domain
SMARTSM007171.5E-17251299IPR001005SANT/Myb domain
PfamPF002491.8E-16252294IPR001005SANT/Myb domain
CDDcd001671.89E-13254297No hitNo description
Gene3DG3DSA:1.10.10.603.0E-22255299IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010439Biological Processregulation of glucosinolate biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1904095Biological Processnegative regulation of endosperm development
GO:2000692Biological Processnegative regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 449 aa     Download sequence    Send to blast
MEFESVIKMH YPYLAAVIYD DSSALKDLHP SLTDDFSCVP SVHHKSIQIN LDMPHLPPKP  60
NTHEIPSKET ISGITPPPCT GAFETYFHGT SNDQSFSGMA NTTSQTIEFN VSDVTHDNTM  120
WKNDQNQGFI FRTESTFNLT MVDSNQFNVV KPVLSTNEDT IIARCQNDQV VIKTEQLKKK  180
NKRLHMRRIC KPAKKTSIVK GQWTSEEDKL LVKLVERHGT KKWSQIAKML QGRVGKQCRE  240
RWHNHLRPDI KKDSWTEEED QILIEAHKEI GNRWAEIARK LPGRTENTIK NHWNATKRRQ  300
HSRRARGKDE ISLALGSNIL QNYIRSITYK DEALMITNTN IGPKNMEGKG KNLMVAVPKY  360
EEDESKYIVD GVMNLGLDDG RKMPSSTAVS TTCASGSAST SGYASGSGSG VTVEFDEPMT  420
DSWMVMHGCD EVMMNEIALL EMINHGHL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C6e-471983002104C-Myb DNA-Binding Domain
1msf_C6e-471983002104C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1176182LKKKNKR
2176194LKKKNKRLHMRRICKPAKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00385DAPTransfer from AT3G27785Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006292464.10.0hypothetical protein CARUB_v10018693mg
TrEMBLR0FRU30.0R0FRU3_9BRAS; Uncharacterized protein
STRINGAT3G27785.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM60522643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.10.0myb domain protein 118